SCOPe 2.07: Domain d1z0nc_: 1z0n C:

Lineage for d1z0nc_ (1z0n C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
   lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)

6. Protein automated matches [190844] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188163] (3 PDB entries)

8. Domain d1z0nc_: 1z0n C: [145957]
   Other proteins in same PDB: d1z0na1
   automated match to d1z0na1
   complexed with bcd

Details for d1z0nc_

PDB Entry: 1z0n, 1.49 Å

PDB Description: the glycogen-binding domain of the amp-activated protein kinase

PDB Compounds: (C:) 5'-AMP-activated protein kinase, beta-1 subunit

SCOPe Domain Sequences for d1z0nc_:

Sequence; same for both SEQRES and ATOM records:

>d1z0nc_ b.1.18.21 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
psepivtsqlgtvnniiqvk

Timeline for d1z0nc_:

• d1z0nc_ first appeared in SCOP 1.75, called d1z0nc1
  
• d1z0nc_ appears in SCOPe 2.06
  
• d1z0nc_ appears in the current release, SCOPe 2.08