Lineage for d1ywhc1 (1ywh C:91-188)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1241631Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1241632Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1241837Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (5 proteins)
  6. 1241886Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 1241887Species Human (Homo sapiens) [TaxId:9606] [161129] (5 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 1241897Domain d1ywhc1: 1ywh C:91-188 [145928]
    automatically matched to 1YWH A:89-188
    complexed with nag, ndg, so4

Details for d1ywhc1

PDB Entry: 1ywh (more details), 2.7 Å

PDB Description: crystal structure of urokinase plasminogen activator receptor
PDB Compounds: (C:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d1ywhc1:

Sequence, based on SEQRES records: (download)

>d1ywhc1 g.7.1.3 (C:91-188) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
ryleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrgcgyl
pgcpgsngfhnndtfhflkccnttkcnegpilelenlp

Sequence, based on observed residues (ATOM records): (download)

>d1ywhc1 g.7.1.3 (C:91-188) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
ryleciscgssdmscergrhqslqcrspeeqcldvvthwiqpkddrhlrgcgylpgcpgs
ngfhnndtfhflkccnttkcnegpilelenlp

SCOPe Domain Coordinates for d1ywhc1:

Click to download the PDB-style file with coordinates for d1ywhc1.
(The format of our PDB-style files is described here.)

Timeline for d1ywhc1: