Lineage for d1ykjb1 (1ykj B:2001-2173,B:2276-2394)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096721Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 2096722Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries)
  8. 2096733Domain d1ykjb1: 1ykj B:2001-2173,B:2276-2394 [145916]
    Other proteins in same PDB: d1ykja2, d1ykjb2
    automatically matched to d1d7la1
    complexed with fad, phb, psl, so4

Details for d1ykjb1

PDB Entry: 1ykj (more details), 2 Å

PDB Description: A45G p-hydroxybenzoate hydroxylase with p-hydroxybenzoate bound
PDB Compounds: (B:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1ykjb1:

Sequence, based on SEQRES records: (download)

>d1ykjb1 c.3.1.2 (B:2001-2173,B:2276-2394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgrirggvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

Sequence, based on observed residues (ATOM records): (download)

>d1ykjb1 c.3.1.2 (B:2001-2173,B:2276-2394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgrirggvleqgmvdllreag
vdrrmarlvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgattvy
qaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrlfl
agdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaerfs
wwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

SCOPe Domain Coordinates for d1ykjb1:

Click to download the PDB-style file with coordinates for d1ykjb1.
(The format of our PDB-style files is described here.)

Timeline for d1ykjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ykjb2