PDB entry 1ykj

View 1ykj on RCSB PDB site
Description: A45G p-hydroxybenzoate hydroxylase with p-hydroxybenzoate bound
Class: oxidoreductase
Keywords: phbh, catalysis, conformations, OXIDOREDUCTASE
Deposited on 2005-01-18, released 2005-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-hydroxybenzoate hydroxylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: POBA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20586
      • engineered (44)
    Domains in SCOPe 2.08: d1ykja1, d1ykja2
  • Chain 'B':
    Compound: p-hydroxybenzoate hydroxylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: POBA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20586 (0-393)
      • engineered (44)
    Domains in SCOPe 2.08: d1ykjb1, d1ykjb2
  • Heterogens: SO4, FAD, PHB, PSL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykjA (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgrirggvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekvedwsderfw
    telkarlpsevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyeeie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ykjB (B:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgrirggvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekvedwsderfw
    telkarlpsevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyeeie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykjB (B:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgrirggvleqgmvdllreag
    vdrrmarlvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgattvy
    qaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvfervyp
    fgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekvedwsderfwte
    lkarlpsevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakglnla
    asdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafsqr
    iqqteleyylgseaglatiaenyvglpyeeie