SCOP 1.75: Domain d1y6eb2: 1y6e B:4-80

Lineage for d1y6eb2 (1y6e B:4-80)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (12 PDB entries)
   Uniprot P08515

8. Domain d1y6eb2: 1y6e B:4-80 [145911]
   Other proteins in same PDB: d1y6ea1, d1y6eb1
   automatically matched to d2fhea2

Details for d1y6eb2

PDB Entry: 1y6e, 3 Å

PDB Description: Orthorhombic glutathione S-transferase of Schistosoma japonicum

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d1y6eb2:

Sequence; same for both SEQRES and ATOM records:

>d1y6eb2 c.47.1.5 (B:4-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidgdvk
ltqsmaiiryiadkhnm

Timeline for d1y6eb2:

• d1y6eb2 is new in SCOP 1.75
  
• d1y6eb2 appears in SCOPe 2.01
  
• d1y6eb2 appears in the current release, SCOPe 2.08