Lineage for d2fhea2 (2fhe A:1-80)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833722Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 833733Protein Class alpha GST [81360] (8 species)
  7. 833749Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries)
  8. 833750Domain d2fhea2: 2fhe A:1-80 [33018]
    Other proteins in same PDB: d2fhea1, d2fheb1

Details for d2fhea2

PDB Entry: 2fhe (more details), 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione
PDB Compounds: (A:) protein (glutathione s-transferase)

SCOP Domain Sequences for d2fhea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]}
paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
kckltqslailryiadkhgm

SCOP Domain Coordinates for d2fhea2:

Click to download the PDB-style file with coordinates for d2fhea2.
(The format of our PDB-style files is described here.)

Timeline for d2fhea2:

833750
d2fhea2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2fhea1