SCOPe 2.08: Domain d1xw4x1: 1xw4 X:32-137

Lineage for d1xw4x1 (1xw4 X:32-137)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
   beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)

4. Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families)

5. Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins)
   PfamB PB015736

6. Protein Sulfiredoxin [160096] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160097] (6 PDB entries)
   Uniprot Q9BYN0 17-137! Uniprot Q9BYN0 28-137! Uniprot Q9BYN0 30-137

8. Domain d1xw4x1: 1xw4 X:32-137 [145892]
   Other proteins in same PDB: d1xw4x2
   complexed with adp

Details for d1xw4x1

PDB Entry: 1xw4, 2 Å

PDB Description: crystal structure of human sulfiredoxin (srx) in complex with adp

PDB Compounds: (X:) Sulfiredoxin

SCOPe Domain Sequences for d1xw4x1:

Sequence; same for both SEQRES and ATOM records:

>d1xw4x1 d.268.1.4 (X:32-137) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]}
sihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikgaqggd
yfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdlq

Timeline for d1xw4x1:

• d1xw4x1 first appeared in SCOP 1.75
  
• d1xw4x1 appears in SCOPe 2.07