PDB entry 1xw4

View 1xw4 on RCSB PDB site
Description: Crystal Structure of Human Sulfiredoxin (Srx) in Complex with ADP
Class: oxidoreductase
Keywords: sulfiredoxin, cysteine, sulfinic acid, peroxiredoxin, sulphiredoxin, OXIDOREDUCTASE
Deposited on 2004-10-29, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Sulfiredoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BYN0 (4-109)
      • cloning artifact (2-3)
      • modified residue (71)
    Domains in SCOPe 2.07: d1xw4x1, d1xw4x2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1xw4X (X:)
    gphmsihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikga
    qggdyfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xw4X (X:)
    hmsihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikgaqg
    gdyfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdlq