Lineage for d1wrka_ (1wrk A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1734343Protein automated matches [190064] (20 species)
    not a true protein
  7. 1734380Species Human (Homo sapiens) [TaxId:9606] [186813] (23 PDB entries)
  8. 1734382Domain d1wrka_: 1wrk A: [145823]
    automated match to d1ap4a_
    complexed with ca, tfp

Details for d1wrka_

PDB Entry: 1wrk (more details), 2.15 Å

PDB Description: crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (orthrombic crystal form)
PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d1wrka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrka_ a.39.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemide
vdedgsgtvdfdeflvmmvrsm

SCOPe Domain Coordinates for d1wrka_:

Click to download the PDB-style file with coordinates for d1wrka_.
(The format of our PDB-style files is described here.)

Timeline for d1wrka_: