SCOPe 2.08: Domain d1vsqa_: 1vsq A:

Lineage for d1vsqa_ (1vsq A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.1: EIIA-man component-like [53063] (2 proteins)

6. Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species)

7. Species Escherichia coli [TaxId:562] [53065] (4 PDB entries)

8. Domain d1vsqa_: 1vsq A: [145802]
   Other proteins in same PDB: d1vsqc_
   automated match to d1pdoa_

Details for d1vsqa_

PDB Entry: 1vsq

PDB Description: solution nmr structure of the productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system

PDB Compounds: (A:) Mannose-specific phosphotransferase enzyme IIA component

SCOPe Domain Sequences for d1vsqa_:

Sequence; same for both SEQRES and ATOM records:

>d1vsqa_ c.54.1.1 (A:) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalkakpv

Timeline for d1vsqa_:

• d1vsqa_ first appeared in SCOP 1.75, called d1vsqa1
  
• d1vsqa_ appears in SCOPe 2.07