| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) ![]() active dimer is formed by strand 5 swapping |
| Family c.54.1.1: EIIA-man component-like [53063] (2 proteins) |
| Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species) |
| Species Escherichia coli [TaxId:562] [53065] (4 PDB entries) |
| Domain d1vsqa_: 1vsq A: [145802] Other proteins in same PDB: d1vsqc_ automated match to d1pdoa_ |
PDB Entry: 1vsq (more details)
SCOPe Domain Sequences for d1vsqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsqa_ c.54.1.1 (A:) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalkakpv
Timeline for d1vsqa_: