PDB entry 1vsq

View 1vsq on RCSB PDB site
Description: Solution NMR structure of the productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system
Class: transferase
Keywords: phosphotransferase, sugar transport, transferase, transferase-phosphocarrier complex, Membrane, Phosphoprotein, Phosphotransferase system
Deposited on 2008-01-10, released 2008-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannose-specific phosphotransferase enzyme IIA component
    Species: Escherichia coli [TaxId:562]
    Gene: manX, gptB, ptsL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vsqa_
  • Chain 'B':
    Compound: Mannose-specific phosphotransferase enzyme IIA component
    Species: Escherichia coli [TaxId:562]
    Gene: manX, gptB, ptsL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vsqb_
  • Chain 'C':
    Compound: Mannose-specific phosphotransferase enzyme IIB component
    Species: Escherichia coli [TaxId:562]
    Gene: manX, gptB, ptsL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vsqc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsqA (A:)
    tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
    vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
    gregvkalkakpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsqB (B:)
    tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
    vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
    gregvkalkakpv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsqC (C:)
    ndymviglariddrlihgqvatrwtketnvsriivvsdevaadtvrktlltqvappgvta
    hvvdvakmirvynnpkyagervmllftnptdverlveggvkitsvnvggmafrqgktqvn
    navsvdekdieafkklnargielevrkvstdpklkmmdliskidk