Lineage for d1vspi1 (1vsp I:1-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787772Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2787773Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2787774Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2787775Protein Ribosomal protein L14 [50195] (5 species)
  7. 2787858Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries)
    Uniprot Q5SHP8 1-122
  8. 2787865Domain d1vspi1: 1vsp I:1-122 [145795]
    Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1, d1vspz1

Details for d1vspi1

PDB Entry: 1vsp (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
PDB Compounds: (I:) 50S ribosomal protein L14

SCOPe Domain Sequences for d1vspi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vspi1 b.39.1.1 (I:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl

SCOPe Domain Coordinates for d1vspi1:

Click to download the PDB-style file with coordinates for d1vspi1.
(The format of our PDB-style files is described here.)

Timeline for d1vspi1: