Class b: All beta proteins [48724] (180 folds) |
Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) automatically mapped to Pfam PF00238 |
Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
Protein Ribosomal protein L14 [50195] (5 species) |
Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries) Uniprot Q5SHP8 1-122 |
Domain d1vspi1: 1vsp I:1-122 [145795] Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1, d1vspz1 |
PDB Entry: 1vsp (more details), 3.83 Å
SCOPe Domain Sequences for d1vspi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vspi1 b.39.1.1 (I:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]} miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape vl
Timeline for d1vspi1: