Lineage for d1vsps1 (1vsp S:2-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2783938Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2783981Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 2784062Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries)
    Uniprot Q72I15 2-102
  8. 2784071Domain d1vsps1: 1vsp S:2-102 [145799]
    Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vspt1, d1vspz1

Details for d1vsps1

PDB Entry: 1vsp (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
PDB Compounds: (S:) 50S ribosomal protein L24

SCOPe Domain Sequences for d1vsps1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsps1 b.34.5.1 (S:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc

SCOPe Domain Coordinates for d1vsps1:

Click to download the PDB-style file with coordinates for d1vsps1.
(The format of our PDB-style files is described here.)

Timeline for d1vsps1: