Lineage for d1s6la1 (1s6l A:21-80)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479900Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein)
  6. 1479901Protein Alkylmercury lyase MerB [158324] (1 species)
  7. 1479902Species Escherichia coli [TaxId:562] [158325] (7 PDB entries)
    Uniprot P77072 21-80
  8. 1479915Domain d1s6la1: 1s6l A:21-80 [145773]
    Other proteins in same PDB: d1s6la2

Details for d1s6la1

PDB Entry: 1s6l (more details)

PDB Description: Solution structure of MerB, the Organomercurial Lyase involved in the bacterial mercury resistance system
PDB Compounds: (A:) Alkylmercury lyase

SCOPe Domain Sequences for d1s6la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6la1 a.4.5.79 (A:21-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
adllvpllrelakgrpvsrttlagildwpaervaavleqatsteydkdgniigygltlre

SCOPe Domain Coordinates for d1s6la1:

Click to download the PDB-style file with coordinates for d1s6la1.
(The format of our PDB-style files is described here.)

Timeline for d1s6la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s6la2