SCOPe 2.07: Domain d2oyic2: 2oyi C:96-141

Lineage for d2oyic2 (2oyi C:96-141)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d2oyic2: 2oyi C:96-141 [145741]
   Other proteins in same PDB: d2oyia1, d2oyic1, d2oyid1
   automatically matched to 2OYH C:96-141
   complexed with ca

Details for d2oyic2

PDB Entry: 2oyi, 2.7 Å

PDB Description: crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide

PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d2oyic2:

Sequence; same for both SEQRES and ATOM records:

>d2oyic2 h.1.8.1 (C:96-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d2oyic2:

• d2oyic2 first appeared in SCOP 1.75
  
• d2oyic2 appears in SCOPe 2.06
  
• d2oyic2 appears in the current release, SCOPe 2.08