Lineage for d2ovpb1 (2ovp B:2263-2364)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926972Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 926973Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 926974Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 926979Protein F-box/WD repeat-containing protein 7, FBXW7 [158808] (1 species)
  7. 926980Species Human (Homo sapiens) [TaxId:9606] [158809] (3 PDB entries)
    Uniprot Q969H0 263-364
  8. 926983Domain d2ovpb1: 2ovp B:2263-2364 [145731]
    Other proteins in same PDB: d2ovpa1, d2ovpa2, d2ovpb2

Details for d2ovpb1

PDB Entry: 2ovp (more details), 2.9 Å

PDB Description: Structure of the Skp1-Fbw7 complex
PDB Compounds: (B:) F-box/WD repeat protein 7

SCOPe Domain Sequences for d2ovpb1:

Sequence, based on SEQRES records: (download)

>d2ovpb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr
ekckeegideplhikrrkvikpgfihspwksayirqhridtn

Sequence, based on observed residues (ATOM records): (download)

>d2ovpb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr
ekckeegideplhikvikpgfihspwksayirqhridtn

SCOPe Domain Coordinates for d2ovpb1:

Click to download the PDB-style file with coordinates for d2ovpb1.
(The format of our PDB-style files is described here.)

Timeline for d2ovpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovpb2