SCOPe 2.04: Domain d2nu0i1: 2nu0 I:6-56

Lineage for d2nu0i1 (2nu0 I:6-56)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (36 PDB entries)

8. Domain d2nu0i1: 2nu0 I:6-56 [145695]
   Other proteins in same PDB: d2nu0e_

Details for d2nu0i1

PDB Entry: 2nu0, 1.95 Å

PDB Description: molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i, and tyr18i

PDB Compounds: (I:) Ovomucoid

SCOPe Domain Sequences for d2nu0i1:

Sequence; same for both SEQRES and ATOM records:

>d2nu0i1 g.68.1.1 (I:6-56) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactweyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Timeline for d2nu0i1:

• d2nu0i1 first appeared in SCOP 1.75
  
• d2nu0i1 appears in SCOPe 2.03
  
• d2nu0i1 appears in SCOPe 2.05
  
• d2nu0i1 appears in the current release, SCOPe 2.08