Lineage for d2iw9a2 (2iw9 A:1-297)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218765Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2218766Species Human (Homo sapiens) [TaxId:9606] [88856] (374 PDB entries)
    Uniprot P24941
  8. 2218973Domain d2iw9a2: 2iw9 A:1-297 [145546]
    Other proteins in same PDB: d2iw9a3, d2iw9b1, d2iw9b2, d2iw9c3, d2iw9d1, d2iw9d2
    automated match to d1ogua_
    complexed with 4sp, mg, sgm

Details for d2iw9a2

PDB Entry: 2iw9 (more details), 2 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor
PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d2iw9a2:

Sequence, based on SEQRES records: (download)

>d2iw9a2 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records): (download)

>d2iw9a2 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirlegvpstaireisllkelnhpniv
klldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchshrvl
hrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystav
diwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwa
rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d2iw9a2:

Click to download the PDB-style file with coordinates for d2iw9a2.
(The format of our PDB-style files is described here.)

Timeline for d2iw9a2: