Lineage for d2io2c1 (2io2 C:432-587)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746487Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 1746488Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 1746489Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)
  7. 1746490Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
    Uniprot P46060 431-587! Uniprot P46060 432-587
  8. 1746498Domain d2io2c1: 2io2 C:432-587 [145535]
    Other proteins in same PDB: d2io2a_, d2io2b_
    forms segment-swapped dimer

Details for d2io2c1

PDB Entry: 2io2 (more details), 2.9 Å

PDB Description: crystal structure of human senp2 in complex with rangap1-sumo-1
PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d2io2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io2c1 a.118.12.1 (C:432-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalesssfarhsllqtlykv

SCOPe Domain Coordinates for d2io2c1:

Click to download the PDB-style file with coordinates for d2io2c1.
(The format of our PDB-style files is described here.)

Timeline for d2io2c1: