Lineage for d2io2a_ (2io2 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634627Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1634645Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)
  7. 1634646Species Human (Homo sapiens) [TaxId:9606] [110772] (6 PDB entries)
    Uniprot Q9HC62 366-589
  8. 1634654Domain d2io2a_: 2io2 A: [145534]
    Other proteins in same PDB: d2io2b_, d2io2c1
    automated match to d2io0a1

Details for d2io2a_

PDB Entry: 2io2 (more details), 2.9 Å

PDB Description: crystal structure of human senp2 in complex with rangap1-sumo-1
PDB Compounds: (A:) Sentrin-specific protease 2

SCOPe Domain Sequences for d2io2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io2a_ d.3.1.7 (A:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
lleltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllv
ernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvi
dlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqln
gsdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

SCOPe Domain Coordinates for d2io2a_:

Click to download the PDB-style file with coordinates for d2io2a_.
(The format of our PDB-style files is described here.)

Timeline for d2io2a_: