Lineage for d2hgqw1 (2hgq W:3-95)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193691Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1193692Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1193693Family d.12.1.1: L23p [54190] (1 protein)
  6. 1193694Protein Ribosomal protein L23 [54191] (4 species)
  7. 1193792Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries)
  8. 1193796Domain d2hgqw1: 2hgq W:3-95 [145357]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqx1, d2hgqy1
    automatically matched to d1n88a_

Details for d2hgqw1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (W:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2hgqw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqw1 d.12.1.1 (W:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
kkrlgrylgkrpdrkkaivqvapgqkiealegl

SCOPe Domain Coordinates for d2hgqw1:

Click to download the PDB-style file with coordinates for d2hgqw1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqw1: