| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) ![]() |
| Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins) |
| Protein Potassium channel protein [56901] (2 species) |
| Species Streptomyces coelicolor [TaxId:1902] [56902] (28 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
| Domain d2h8pc1: 2h8p C:22-78 [145292] synthetic ligation with chain D fragment complexed with b3h, goa, k |
PDB Entry: 2h8p (more details), 2.25 Å
SCOP Domain Sequences for d2h8pc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy
Timeline for d2h8pc1: