SCOPe 2.08: Domain d2h8pc1: 2h8p C:22-78

Lineage for d2h8pc1 (2h8p C:22-78)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d2h8pc1: 2h8p C:22-78 [145292]
   synthetic ligation with chain D fragment
   complexed with b3h, goa, k
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2h8pc1

PDB Entry: 2h8p, 2.25 Å

PDB Description: Structure of a K channel with an amide to ester substitution in the selectivity filter

PDB Compounds: (C:) KcsA Channel

SCOPe Domain Sequences for d2h8pc1:

Sequence; same for both SEQRES and ATOM records:

>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy

Timeline for d2h8pc1:

• d2h8pc1 first appeared in SCOP 1.75
  
• d2h8pc1 appears in SCOPe 2.07