Lineage for d2h64a1 (2h64 A:10-114)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638412Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2638436Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species)
  7. 2638437Species Human (Homo sapiens) [TaxId:9606] [57517] (16 PDB entries)
  8. 2638442Domain d2h64a1: 2h64 A:10-114 [145282]
    Other proteins in same PDB: d2h64b_, d2h64c_

Details for d2h64a1

PDB Entry: 2h64 (more details), 1.92 Å

PDB Description: crystal structure of a ternary ligand-receptor complex of bmp-2
PDB Compounds: (A:) Bone morphogenetic protein 2

SCOPe Domain Sequences for d2h64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h64a1 g.17.1.2 (A:10-114) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]}
lkssckrhplyvdfsdvgwndwivappgyhafychgecpfpladhlnstnhaivqtlvns
vnskipkaccvptelsaismlyldenekvvkkdyqdmvvegcgcr

SCOPe Domain Coordinates for d2h64a1:

Click to download the PDB-style file with coordinates for d2h64a1.
(The format of our PDB-style files is described here.)

Timeline for d2h64a1: