Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
Protein beta-hexosaminidase A [160560] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries) Uniprot P06865 23-166 |
Domain d2gjxh2: 2gjx H:23-166 [145209] Other proteins in same PDB: d2gjxa1, d2gjxb1, d2gjxb2, d2gjxc1, d2gjxc2, d2gjxd1, d2gjxe1, d2gjxf1, d2gjxf2, d2gjxg1, d2gjxg2, d2gjxh1 automated match to d2gjxa2 complexed with nag, so4 |
PDB Entry: 2gjx (more details), 2.8 Å
SCOPe Domain Sequences for d2gjxh2:
Sequence, based on SEQRES records: (download)
>d2gjxh2 d.92.2.1 (H:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf sqlvwksaegtffinkteiedfpr
>d2gjxh2 d.92.2.1 (H:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi nkteiedfpr
Timeline for d2gjxh2: