SCOP 1.75: Domain d2g4dc1: 2g4d C:440-643

Lineage for d2g4dc1 (2g4d C:440-643)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (5 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 1 [142862] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142863] (4 PDB entries)
   Uniprot Q9P0U3 419-643

8. Domain d2g4dc1: 2g4d C:440-643 [145185]
   Other proteins in same PDB: d2g4db1, d2g4dd1
   automatically matched to 2G4D A:440-643
   mutant

Details for d2g4dc1

PDB Entry: 2g4d, 2.8 Å

PDB Description: crystal structure of human senp1 mutant (c603s) in complex with sumo-1

PDB Compounds: (C:) SENP1 protein

SCOP Domain Sequences for d2g4dc1:

Sequence; same for both SEQRES and ATOM records:

>d2g4dc1 d.3.1.7 (C:440-643) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]}
qdevlseafrltitrkdiqtlnhlnwlndeiinfymnmlmerskekglpsvhafntffft
klktagyqavkrwtkkvdvfsvdillvpihlgvhwclavvdfrkknityydsmgginnea
crillqylkqesidkkrkefdtngwqlfskksqeipqqmngsdsgmfackyadcitkdrp
inftqqhmpyfrkrmvweilhrkl

Timeline for d2g4dc1:

• d2g4dc1 is new in SCOP 1.75
  
• d2g4dc1 is called d2g4dc_ in SCOPe 2.01
  
• d2g4dc1 appears in the current release, SCOPe 2.08, called d2g4dc_