Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) |
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54242] (14 PDB entries) Uniprot Q93068 |
Domain d2g4dd1: 2g4d D:20-97 [134591] Other proteins in same PDB: d2g4da1, d2g4dc1 automatically matched to d1tgzb_ mutant |
PDB Entry: 2g4d (more details), 2.8 Å
SCOP Domain Sequences for d2g4dd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4dd1 d.15.1.1 (D:20-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke lgmeeedvievyqeqtgg
Timeline for d2g4dd1: