Lineage for d2g2wa1 (2g2w A:26-292)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690477Protein beta-Lactamase, class A [56606] (16 species)
  7. 1690577Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (23 PDB entries)
    inhibited by tazobactam
    Uniprot Q5PSW7 ! Uniprot P14557 22-286
  8. 1690597Domain d2g2wa1: 2g2w A:26-292 [145180]
    Other proteins in same PDB: d2g2wb_

Details for d2g2wa1

PDB Entry: 2g2w (more details), 1.8 Å

PDB Description: crystal structure of the shv d104k beta-lactamase/beta-lactamase inhibitor protein (blip) complex
PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d2g2wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g2wa1 e.3.1.1 (A:26-292) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvkyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

SCOPe Domain Coordinates for d2g2wa1:

Click to download the PDB-style file with coordinates for d2g2wa1.
(The format of our PDB-style files is described here.)

Timeline for d2g2wa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2g2wb_