SCOP 1.75: Domain d2f4ma1: 2f4m A:164-450

Lineage for d2f4ma1 (2f4m A:164-450)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (2 proteins)

6. Protein Peptide:N-glycanase 1, PNG1 [142852] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159840] (2 PDB entries)
   Uniprot Q9JI78 164-450

8. Domain d2f4ma1: 2f4m A:164-450 [145135]
   Other proteins in same PDB: d2f4mb1
   complexed with cl, zn

Details for d2f4ma1

PDB Entry: 2f4m, 1.85 Å

PDB Description: The Mouse PNGase-HR23 Complex Reveals a Complete Remodulation of the Protein-Protein Interface Compared to its Yeast Orthologs

PDB Compounds: (A:) peptide N-glycanase

SCOP Domain Sequences for d2f4ma1:

Sequence; same for both SEQRES and ATOM records:

>d2f4ma1 d.3.1.4 (A:164-450) Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) [TaxId: 10090]}
gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
eellretinglnkqrqlslsesrrkellqriivelvefispktprpg

Timeline for d2f4ma1:

• d2f4ma1 is new in SCOP 1.75
  
• d2f4ma1 appears in SCOPe 2.01
  
• d2f4ma1 appears in the current release, SCOPe 2.08