![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.189: XPC-binding domain [101237] (1 superfamily) 4 helices; array |
![]() | Superfamily a.189.1: XPC-binding domain [101238] (1 family) ![]() |
![]() | Family a.189.1.1: XPC-binding domain [101239] (3 proteins) |
![]() | Protein XPC-binding domain of Rad23 homolog B (Hhr23b) [109851] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109852] (3 PDB entries) Uniprot P54727 275-342 # structure of the N-terminal domain (1-87) is also known ((102778)) |
![]() | Domain d2f4mb1: 2f4m B:275-332 [132931] Other proteins in same PDB: d2f4ma1 automatically matched to d1pvea_ complexed with cl, zn |
PDB Entry: 2f4m (more details), 1.85 Å
SCOP Domain Sequences for d2f4mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} pleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepv
Timeline for d2f4mb1: