Lineage for d2esve1 (2esv E:3-118)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931508Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 931526Domain d2esve1: 2esv E:3-118 [145126]
    Other proteins in same PDB: d2esva1, d2esva2, d2esvb_, d2esvd2, d2esve2
    complexed with iod

Details for d2esve1

PDB Entry: 2esv (more details), 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex
PDB Compounds: (E:) KK50.4 T cell receptor beta chain

SCOPe Domain Sequences for d2esve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqfpshsviekgqtvtlrcdpisghdnlywyrrvmgkeikfllhfvkeskqdesgmpn
nrflaertggtystlkvqpaeledsgvyfcassqdrdtqyfgpgtrltvle

SCOPe Domain Coordinates for d2esve1:

Click to download the PDB-style file with coordinates for d2esve1.
(The format of our PDB-style files is described here.)

Timeline for d2esve1: