Lineage for d2dtge2 (2dtg E:593-807)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1109778Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1109779Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1110046Protein Insulin receptor [158901] (1 species)
  7. 1110047Species Human (Homo sapiens) [TaxId:9606] [158902] (1 PDB entry)
    Uniprot P06213 495-618
  8. 1110049Domain d2dtge2: 2dtg E:593-807 [145101]
    Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgd1, d2dtge4, d2dtge5, d2dtge6

Details for d2dtge2

PDB Entry: 2dtg (more details), 3.8 Å

PDB Description: insulin receptor (ir) ectodomain in complex with fab's
PDB Compounds: (E:) Insulin receptor

SCOPe Domain Sequences for d2dtge2:

Sequence, based on SEQRES records: (download)

>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
tnpsvpldpisvsnsssqiilkwkppsdpngnithylvfwerqaedselfeldyclkglk
lpsrtwsppfesedsqkhnqseyedsageccscpktdsqilkeleessfrktfedylhnv
vfvprpsrkrrslgdvgnagnneehrpfekvvnkeslvisglrhftgyrielqacnqdtp
eercsvaayvsartmp

Sequence, based on observed residues (ATOM records): (download)

>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
tnpsvpldpisvsnsssqiilkwkppsdpngnithylvfwerqaedselfeldyclkglk
lpsehrpfekvvnkeslvisglrhftgyrielqacnqdtpeercsvaayvsartmp

SCOPe Domain Coordinates for d2dtge2:

Click to download the PDB-style file with coordinates for d2dtge2.
(The format of our PDB-style files is described here.)

Timeline for d2dtge2: