SCOPe 2.07: Domain d2cdec1: 2cde C:2-115

Lineage for d2cdec1 (2cde C:2-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d2cdec1: 2cde C:2-115 [145029]
   Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
   automatically matched to 2CDE A:2-115

Details for d2cdec1

PDB Entry: 2cde, 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr

PDB Compounds: (C:) inkt-tcr

SCOPe Domain Sequences for d2cdec1:

Sequence; same for both SEQRES and ATOM records:

>d2cdec1 b.1.1.2 (C:2-115) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

Timeline for d2cdec1:

• d2cdec1 first appeared in SCOP 1.75
  
• d2cdec1 appears in SCOPe 2.06
  
• d2cdec1 appears in the current release, SCOPe 2.08