Lineage for d2b5rb_ (2b5r B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690477Protein beta-Lactamase, class A [56606] (16 species)
  7. 1690502Species Escherichia coli, TEM-1 [TaxId:562] [56607] (37 PDB entries)
  8. 1690514Domain d2b5rb_: 2b5r B: [144953]
    Other proteins in same PDB: d2b5rc_, d2b5rd_
    automated match to d2b5ra1

Details for d2b5rb_

PDB Entry: 2b5r (more details), 1.65 Å

PDB Description: 1b lactamase / b lactamase inhibitor
PDB Compounds: (B:) Beta-lactamase TEM

SCOPe Domain Sequences for d2b5rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5rb_ e.3.1.1 (B:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
agqeqlgrrihysqndlvynspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d2b5rb_:

Click to download the PDB-style file with coordinates for d2b5rb_.
(The format of our PDB-style files is described here.)

Timeline for d2b5rb_: