SCOPe 2.02: Domain d2aw2a1: 2aw2 A:34-137

Lineage for d2aw2a1 (2aw2 A:34-137)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein B- and T-lymphocyte attenuator CD272 [158869] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158870] (1 PDB entry)
   Uniprot Q7Z6A9 34-137

8. Domain d2aw2a1: 2aw2 A:34-137 [144863]
   Other proteins in same PDB: d2aw2b1, d2aw2b2, d2aw2y1, d2aw2y2
   complexed with ni

Details for d2aw2a1

PDB Entry: 2aw2, 2.8 Å

PDB Description: crystal structure of the human btla-hvem complex

PDB Compounds: (A:) B and T lymphocyte attenuator

SCOPe Domain Sequences for d2aw2a1:

Sequence; same for both SEQRES and ATOM records:

>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]}
cdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeek
nisffilhfepvlpndngsyrcsanfqsnlieshsttlyvtdvk

Timeline for d2aw2a1:

• d2aw2a1 first appeared in SCOP 1.75
  
• d2aw2a1 appears in SCOPe 2.01
  
• d2aw2a1 appears in SCOPe 2.03
  
• d2aw2a1 appears in the current release, SCOPe 2.08