Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins) barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms |
Protein Gene 32 protein (gp32) core [50319] (2 species) contains a Zn-finger subdomain, res. 63-111 |
Species Enterobacteria phage RB69 [TaxId:12353] [159108] (1 PDB entry) Uniprot Q7Y265 32-241 |
Domain d2atqb1: 2atq B:32-241 [144839] Other proteins in same PDB: d2atqa1, d2atqa2 protein/DNA complex; complexed with gdp, zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 2atq (more details), 3.2 Å
SCOPe Domain Sequences for d2atqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atqb1 b.40.4.7 (B:32-241) Gene 32 protein (gp32) core {Enterobacteria phage RB69 [TaxId: 12353]} klkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcssthgdydscpvcq yiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfgkkiwdkinami avdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipniddesfqkelfe qmvdlsemtskdkfksfeelntkfnqvlgt
Timeline for d2atqb1: