Lineage for d2atqb1 (2atq B:32-241)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. Protein Gene 32 protein (gp32) core [50319] (2 species)
    contains a Zn-finger subdomain, res. 63-111
  7. Species Enterobacteria phage RB69 [TaxId:12353] [159108] (1 PDB entry)
    Uniprot Q7Y265 32-241
  8. Domain d2atqb1: 2atq B:32-241 [144839]
    Other proteins in same PDB: d2atqa1, d2atqa2
    protein/DNA complex; complexed with gdp, zn
    has additional subdomain(s) that are not in the common domain

Details for d2atqb1

PDB Entry: 2atq (more details), 3.2 Å

PDB Description: rb69 single-stranded dna binding protein-dna polymerase fusion
PDB Compounds: (B:) gp32

SCOPe Domain Sequences for d2atqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atqb1 b.40.4.7 (B:32-241) Gene 32 protein (gp32) core {Enterobacteria phage RB69 [TaxId: 12353]}
klkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcssthgdydscpvcq
yiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfgkkiwdkinami
avdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipniddesfqkelfe
qmvdlsemtskdkfksfeelntkfnqvlgt

SCOPe Domain Coordinates for d2atqb1 are not available.

Timeline for d2atqb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2atqa1, d2atqa2