Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
Domain d2aq3a1: 2aq3 A:2-117 [144825] Other proteins in same PDB: d2aq3b1, d2aq3b2, d2aq3c_, d2aq3d1, d2aq3d2, d2aq3e_, d2aq3f1, d2aq3f2, d2aq3g_, d2aq3h1, d2aq3h2 |
PDB Entry: 2aq3 (more details), 2.3 Å
SCOPe Domain Sequences for d2aq3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq3a1 b.1.1.1 (A:2-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
Timeline for d2aq3a1: