![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
![]() | Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (22 PDB entries) SQ NA # camelid antibody |
![]() | Domain d1zv5a1: 1zv5 A:2-120 [144771] Other proteins in same PDB: d1zv5l1 complexed with po4 |
PDB Entry: 1zv5 (more details), 2 Å
SCOP Domain Sequences for d1zv5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zv5a1 b.1.1.1 (A:2-120) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} vqlvesgggsvqageslrlscaasgvtyknycigwfrqapgkdregvvfinsdggityya dsvkgrftisqdnakntvylqmnslkpedtasyycaagyrnygqcatrywgqgtqvtvs
Timeline for d1zv5a1: