Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries) SQ NA # camelid antibody |
Domain d1zv5a1: 1zv5 A:2-120 [144771] Other proteins in same PDB: d1zv5l_ complexed with po4 |
PDB Entry: 1zv5 (more details), 2 Å
SCOPe Domain Sequences for d1zv5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zv5a1 b.1.1.1 (A:2-120) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} vqlvesgggsvqageslrlscaasgvtyknycigwfrqapgkdregvvfinsdggityya dsvkgrftisqdnakntvylqmnslkpedtasyycaagyrnygqcatrywgqgtqvtvs
Timeline for d1zv5a1: