SCOPe 2.08: Domain d1zt7a1: 1zt7 A:181-275

Lineage for d1zt7a1 (1zt7 A:181-275)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
   Uniprot P01901 22-299

8. Domain d1zt7a1: 1zt7 A:181-275 [144767]
   Other proteins in same PDB: d1zt7a2, d1zt7b1, d1zt7c2, d1zt7d1
   automatically matched to 1ZT1 A:181-276

Details for d1zt7a1

PDB Entry: 1zt7, 3 Å

PDB Description: crystal structure of class i mhc h-2kk in complex with a nonapeptide

PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-K alpha chain

SCOPe Domain Sequences for d1zt7a1:

Sequence; same for both SEQRES and ATOM records:

>d1zt7a1 b.1.1.2 (A:181-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
rtdspkahvtrhsrpedkvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwasvvvplgkeqyytchvyhqglpepltlrwe

Timeline for d1zt7a1:

• d1zt7a1 first appeared in SCOP 1.75
  
• d1zt7a1 appears in SCOPe 2.07