PDB entry 1zt7

View 1zt7 on RCSB PDB site
Description: crystal structure of class I MHC H-2Kk in complex with a nonapeptide
Class: immune system
Keywords: peptide binding groove, IMMUNE SYSTEM
Deposited on 2005-05-26, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.235
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, K-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zt7a1, d1zt7a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zt7b1
  • Chain 'C':
    Compound: H-2 class I histocompatibility antigen, K-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zt7c1, d1zt7c2
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zt7d1
  • Chain 'P':
    Compound: SV40 epitope, SEFLLEKRI
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZT7 (0-8)
  • Chain 'Q':
    Compound: SV40 epitope, SEFLLEKRI
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZT7 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zt7A (A:)
    mgphslryfhtavsrpglgkprfisvgyvddtqfvrfdsdaenpryeprvrwmeqvepey
    werntqiakgneqifrvnlrtalryynqsaggshtfqrmygcevgsdwrllrgyeqyayd
    gcdyialnedlktwtaadmaalitkhkweqagdaerdraylegtcvewlrrylqlgnatl
    prtdspkahvtrhsrpedkvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zt7A (A:)
    gphslryfhtavsrpglgkprfisvgyvddtqfvrfdsdaenpryeprvrwmeqvepeyw
    erntqiakgneqifrvnlrtalryynqsaggshtfqrmygcevgsdwrllrgyeqyaydg
    cdyialnedlktwtaadmaalitkhkweqagdaerdraylegtcvewlrrylqlgnatlp
    rtdspkahvtrhsrpedkvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zt7B (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zt7B (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zt7C (C:)
    mgphslryfhtavsrpglgkprfisvgyvddtqfvrfdsdaenpryeprvrwmeqvepey
    werntqiakgneqifrvnlrtalryynqsaggshtfqrmygcevgsdwrllrgyeqyayd
    gcdyialnedlktwtaadmaalitkhkweqagdaerdraylegtcvewlrrylqlgnatl
    prtdspkahvtrhsrpedkvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zt7C (C:)
    gphslryfhtavsrpglgkprfisvgyvddtqfvrfdsdaenpryeprvrwmeqvepeyw
    erntqiakgneqifrvnlrtalryynqsaggshtfqrmygcevgsdwrllrgyeqyaydg
    cdyialnedlktwtaadmaalitkhkweqagdaerdraylegtcvewlrrylqlgnatlp
    rtdspkahvtrhsrpedkvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zt7D (D:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zt7D (D:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.