Lineage for d1ykoj_ (1yko J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2769890Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2770099Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2770114Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2770251Domain d1ykoj_: 1yko J: [144682]
    Other proteins in same PDB: d1ykoa_, d1ykoc_, d1ykoe_, d1ykog_, d1ykoi_, d1ykok_
    automated match to d1ykob1
    complexed with fe; mutant

Details for d1ykoj_

PDB Entry: 1yko (more details), 2.54 Å

PDB Description: protocatechuate 3,4-dioxygenase y408h mutant
PDB Compounds: (J:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1ykoj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykoj_ b.3.6.1 (J:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrhrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d1ykoj_:

Click to download the PDB-style file with coordinates for d1ykoj_.
(The format of our PDB-style files is described here.)

Timeline for d1ykoj_: