Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries) |
Domain d1ykoc_: 1yko C: [123549] Other proteins in same PDB: d1ykob1, d1ykod_, d1ykof_, d1ykoh_, d1ykoj_, d1ykol_ automated match to d2pcda_ complexed with fe; mutant |
PDB Entry: 1yko (more details), 2.54 Å
SCOPe Domain Sequences for d1ykoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykoc_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]} piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk tayrfdiriqgegetvffdf
Timeline for d1ykoc_: