Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
Species Pseudomonas putida [TaxId:303] [49490] (31 PDB entries) |
Domain d1yklb_: 1ykl B: [144660] Other proteins in same PDB: d1ykla_, d1yklc_, d1ykle_, d1yklg_, d1ykli_, d1yklk_ automated match to d1ykkb1 complexed with dhb, fe; mutant |
PDB Entry: 1ykl (more details), 2.25 Å
SCOPe Domain Sequences for d1yklb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yklb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
Timeline for d1yklb_: