Lineage for d1yaru_ (1yar U:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083591Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 1083592Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 1083605Protein automated matches [190828] (1 species)
    not a true protein
  7. 1083606Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (5 PDB entries)
  8. 1083613Domain d1yaru_: 1yar U: [144621]
    Other proteins in same PDB: d1yara_, d1yarb_, d1yarc_, d1yard_, d1yare_, d1yarf_, d1yarg_, d1yarh_, d1yari_, d1yarj_, d1yark_, d1yarl_, d1yarm_, d1yarn_
    automated match to d1ya7o1
    complexed with gol, so4; mutant

Details for d1yaru_

PDB Entry: 1yar (more details), 1.9 Å

PDB Description: structure of archeabacterial 20s proteasome mutant d9s- pa26 complex
PDB Compounds: (U:) proteasome activator protein PA26

SCOPe Domain Sequences for d1yaru_:

Sequence, based on SEQRES records: (download)

>d1yaru_ a.24.8.1 (U:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d1yaru_ a.24.8.1 (U:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

SCOPe Domain Coordinates for d1yaru_:

Click to download the PDB-style file with coordinates for d1yaru_.
(The format of our PDB-style files is described here.)

Timeline for d1yaru_: