Lineage for d1y1ki1 (1y1k I:21-83)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646962Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1646963Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1646964Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 1646965Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 1646966Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. 1646971Domain d1y1ki1: 1y1k I:21-83 [144584]
    Other proteins in same PDB: d1y1ke_
    complexed with 15p, ca, cit, na; mutant

Details for d1y1ki1

PDB Entry: 1y1k (more details), 1.56 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 t58a mutant
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1y1ki1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1ki1 d.40.1.1 (I:21-83) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpaaqiivlpvgtivameyridrvrlfvdrldniaqvp
rvg

SCOPe Domain Coordinates for d1y1ki1:

Click to download the PDB-style file with coordinates for d1y1ki1.
(The format of our PDB-style files is described here.)

Timeline for d1y1ki1: