Lineage for d1wr6a1 (1wr6 A:211-300)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081581Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1081818Superfamily a.7.8: GAT-like domain [89009] (2 families) (S)
  5. 1081819Family a.7.8.1: GAT domain [89010] (3 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 1081828Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species)
  7. 1081829Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries)
    Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300
  8. 1081830Domain d1wr6a1: 1wr6 A:211-300 [144561]
    Other proteins in same PDB: d1wr6e_, d1wr6f_, d1wr6g_, d1wr6h_

Details for d1wr6a1

PDB Entry: 1wr6 (more details), 2.6 Å

PDB Description: Crystal structure of GGA3 GAT domain in complex with ubiquitin
PDB Compounds: (A:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1wr6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr6a1 a.7.8.1 (A:211-300) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
vtkrlhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfklasete
dndnslgdilqasdnlsrvinsyktiiegq

SCOPe Domain Coordinates for d1wr6a1:

Click to download the PDB-style file with coordinates for d1wr6a1.
(The format of our PDB-style files is described here.)

Timeline for d1wr6a1: