Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins) |
Protein Insulin-like growth factor-binding protein 4 [161120] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [161121] (1 PDB entry) Uniprot P22692 24-103 |
Domain d1wqjb1: 1wqj B:3-82 [144560] Other proteins in same PDB: d1wqji_ |
PDB Entry: 1wqj (more details), 1.6 Å
SCOPe Domain Sequences for d1wqjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wqjb1 g.3.9.1 (B:3-82) Insulin-like growth factor-binding protein 4 {Human (Homo sapiens) [TaxId: 9606]} aihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcypp rgvekplhtlmhgqgvcmel
Timeline for d1wqjb1: