SCOPe 2.07: Domain d1wcbh2: 1wcb H:114-213

Lineage for d1wcbh2 (1wcb H:114-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (429 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d1wcbh2: 1wcb H:114-213 [144557]
   Other proteins in same PDB: d1wcba1, d1wcba2, d1wcbb1, d1wcbh1, d1wcbl1, d1wcbl2
   automated match to d1wc7b2
   complexed with iod, pe1

Details for d1wcbh2

PDB Entry: 1wcb, 2.5 Å

PDB Description: plp-dependent catalytic antibody 15a9 in complex with its hapten

PDB Compounds: (H:) fab fragment of catalytic antibody 15a9, heavy chain

SCOPe Domain Sequences for d1wcbh2:

Sequence, based on SEQRES records:

>d1wcbh2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1wcbh2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Timeline for d1wcbh2:

• d1wcbh2 first appeared in SCOP 1.75
  
• d1wcbh2 appears in SCOPe 2.06
  
• d1wcbh2 appears in the current release, SCOPe 2.08