Lineage for d1vs7s1 (1vs7 S:2-80)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857955Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 857956Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 857957Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 857958Protein Ribosomal protein S19 [54572] (2 species)
  7. 857959Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 857969Domain d1vs7s1: 1vs7 S:2-80 [144494]
    Other proteins in same PDB: d1vs7b1, d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7k1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7r1, d1vs7t1, d1vs7u1
    automatically matched to 2AVY S:2-80
    complexed with ksg, mg

Details for d1vs7s1

PDB Entry: 1vs7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d1vs7s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs7s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOP Domain Coordinates for d1vs7s1:

Click to download the PDB-style file with coordinates for d1vs7s1.
(The format of our PDB-style files is described here.)

Timeline for d1vs7s1: